| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50247674 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_495234 (CHEMBL998664) |
|---|
| Ki | 5±n/a nM |
|---|
| Citation |  DasGupta, S; Murumkar, PR; Giridhar, R; Yadav, MR Current perspective of TACE inhibitors: a review. Bioorg Med Chem17:444-59 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50247674 |
|---|
| n/a |
|---|
| Name | BDBM50247674 |
|---|
| Synonyms: | 2-[7-(3,5-Dimethoxy-benzyloxy)-1,1-dioxo-1,3,4,5-tetrahydro-1lambda*6*-benzo[f][1,2,5]thiadiazepin-2-yl]-6-methanesulfonylamino-hexanoic acid hydroxyamide | CHEMBL454380 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H34N4O9S2 |
|---|
| Mol. Mass. | 586.678 |
|---|
| SMILES | COc1cc(COc2ccc3c(NCCN(C(CCCCNS(C)(=O)=O)C(=O)NO)S3(=O)=O)c2)cc(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
