Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCation-dependent mannose-6-phosphate receptor
LigandBDBM50293266
Substrate/Competitorn/a
Meas. Tech.ChEMBL_492874
IC50 230000±n/a nM
Citation Jeanjean AGary-Bobo MNirdé PLeiris SGarcia MMorère A Synthesis of new sulfonate and phosphonate derivatives for cation-independent mannose 6-phosphate receptor targeting. Bioorg Med Chem Lett 18:6240-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cation-dependent mannose-6-phosphate receptor
Name:Cation-dependent mannose-6-phosphate receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30989.41
Organism:Homo sapiens (Human)
Description:ChEMBL_492874
Residue:277
Sequence:
MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF
ESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIML
IYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS
PEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGC
DFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293266
n/a
NameBDBM50293266
Synonyms:CHEMBL510805 | mannose 6-sulfonate
TypeSmall organic molecule
Emp. Form.C7H14O8S
Mol. Mass.258.246
SMILESO[C@H]1O[C@H](CCS(O)(=O)=O)[C@@H](O)[C@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: