| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H2 receptor |
|---|
| Ligand | BDBM7966 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_493052 (CHEMBL953166) |
|---|
| EC50 | 1000±n/a nM |
|---|
| Citation |  Ghorai, P; Kraus, A; Keller, M; Götte, C; Igel, P; Schneider, E; Schnell, D; Bernhardt, G; Dove, S; Zabel, M; Elz, S; Seifert, R; Buschauer, A Acylguanidines as bioisosteres of guanidines: NG-acylated imidazolylpropylguanidines, a new class of histamine H2 receptor agonists. J Med Chem51:7193-204 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H2 receptor |
|---|
| Name: | Histamine H2 receptor |
|---|
| Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_CAVPO | Histamine H2-Gs alpha S |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40567.22 |
|---|
| Organism: | Cavia porcellus (domestic guinea pig) |
|---|
| Description: | For the H2 receptor-binding assays, guinea pig striatum was used. |
|---|
| Residue: | 359 |
|---|
| Sequence: | MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
|
|
|
|---|
| BDBM7966 |
|---|
| n/a |
|---|
| Name | BDBM7966 |
|---|
| Synonyms: | 2-(1H-imidazol-4-yl)ethan-1-amine | CHEMBL544208 | CHEMBL90 | Ceplene | Ergotidine | HISTAMINE DIHYDROCHLORIDE | Histamine | L-histamine | Peremin | [3H]histamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C5H9N3 |
|---|
| Mol. Mass. | 111.1451 |
|---|
| SMILES | NCCc1cnc[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
