Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50248969
Substrate/Competitorn/a
Meas. Tech.ChEMBL_543319
Ki 1.3±n/a nM
Citation Moynihan HJales ARGreedy BMRennison DBroadbear JHPurington LTraynor JRWoods JHLewis JWHusbands SM 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem 52:1553-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248969
n/a
NameBDBM50248969
Synonyms:14beta-(4-Chlorocinnamoyloxy)-N-cyclopropylmethyl-7,8-dihydronormorphinone | CHEMBL514927
TypeSmall organic molecule
Emp. Form.C29H28ClNO5
Mol. Mass.505.989
SMILESOc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35OC(=O)\C=C\c1ccc(Cl)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: