Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50248990
Substrate/Competitorn/a
Meas. Tech.ChEMBL_543321
Ki 8.1±n/a nM
Citation Moynihan HJales ARGreedy BMRennison DBroadbear JHPurington LTraynor JRWoods JHLewis JWHusbands SM 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem 52:1553-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248990
n/a
NameBDBM50248990
Synonyms:14beta-(4-Methylcinnamoyloxy)-N-cyclopropylmethyl-7,8-dihydronormorphinone | CHEMBL474641
TypeSmall organic molecule
Emp. Form.C30H31NO5
Mol. Mass.485.5708
SMILESCc1ccc(\C=C\C(=O)O[C@]23CCC(=O)[C@@H]4Oc5c6c(C[C@H]2N(CC2CC2)CC[C@@]346)ccc5O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: