Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VB
LigandBDBM50248167
Substrate/Competitorn/a
Meas. Tech.ChEMBL_565859
Ki 40.9±n/a nM
Citation Crocetti LMaresca ATemperini CHall RAScozzafava AMühlschlegel FASupuran CT A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases. Bioorg Med Chem Lett 19:1371-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VB
Name:Carbonic Anhydrase VB
Synonyms:CA-VB | Carbonate dehydratase VB | Carbonic anhydrase 5B (CA VB) | Carbonic anhydrase 5B, mitochondrial | Carbonic anhydrase 5B, mitochondrial precursor | Carbonic anhydrase VB (CA VB)
Type:Enzyme
Mol. Mass.:36440.83
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:317
Sequence:
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248167
n/a
NameBDBM50248167
Synonyms:2-(1,3-thiazol-4-yl)-1H-benzimidazole-5-sulfonamide | 2-(thiazol-4-yl)-1H-benzo[d]imidazole-5-sulfonamide | CHEMBL455271
TypeSmall organic molecule
Emp. Form.C10H8N4O2S2
Mol. Mass.280.326
SMILESNS(=O)(=O)c1ccc2nc([nH]c2c1)-c1cscn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: