| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sortase family protein |
|---|
| Ligand | BDBM26658 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_567074 (CHEMBL1030753) |
|---|
| IC50 | 37390±n/a nM |
|---|
| Citation |  Kudryavtsev, KV; Bentley, ML; McCafferty, DG Probing of the cis-5-phenyl proline scaffold as a platform for the synthesis of mechanism-based inhibitors of the Staphylococcus aureus sortase SrtA isoform. Bioorg Med Chem17:2886-93 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sortase family protein |
|---|
| Name: | Sortase family protein |
|---|
| Synonyms: | Sortase | Sortase A (SrtA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23546.15 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
LITCDDYNEKTGVWEKRKIFVATEVK
|
|
|
|---|
| BDBM26658 |
|---|
| n/a |
|---|
| Name | BDBM26658 |
|---|
| Synonyms: | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-1-benzopyran-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxychromen-4-one | 2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one | CHEMBL28626 | MLS000069618 | Morin (19) | Morin (5) | Morin (Mor) | SMR000058259 | cid_5281670 | morin |
|---|
| Type | Flavonoid |
|---|
| Emp. Form. | C15H10O7 |
|---|
| Mol. Mass. | 302.2357 |
|---|
| SMILES | Oc1ccc(c(O)c1)-c1oc2cc(O)cc(O)c2c(=O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
