| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM7478 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_563791 (CHEMBL993554) |
|---|
| IC50 | 6±n/a nM |
|---|
| Citation |  Gray, NS; Wodicka, L; Thunnissen, AM; Norman, TC; Kwon, S; Espinoza, FH; Morgan, DO; Barnes, G; LeClerc, S; Meijer, L; Kim, SH; Lockhart, DJ; Schultz, PG Exploiting chemical libraries, structure, and genomics in the search for kinase inhibitors. Science281:533-538 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM7478 |
|---|
| n/a |
|---|
| Name | BDBM7478 |
|---|
| Synonyms: | 2-chloro-4-[(2-{[(1R)-1-(hydroxymethyl)-2-methylpropyl]amino}-9-isopropyl-9H-purin-6-yl)amino]benzoic acid | 2-chloro-4-[(2-{[(2R)-1-hydroxy-3-methylbutan-2-yl]amino}-9-(propan-2-yl)-9H-purin-6-yl)amino]benzoic acid | CHEMBL23254 | Purvalanol B |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25ClN6O3 |
|---|
| Mol. Mass. | 432.904 |
|---|
| SMILES | CC(C)[C@H](CO)Nc1nc(Nc2ccc(C(O)=O)c(Cl)c2)c2ncn(C(C)C)c2n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
