Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50266862 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_563773 (CHEMBL993536) |
---|
Ki | 1.34±n/a nM |
---|
Citation | Yanamoto, K; Kumata, K; Yamasaki, T; Odawara, C; Kawamura, K; Yui, J; Hatori, A; Suzuki, K; Zhang, MR [18F]FEAC and [18F]FEDAC: Two novel positron emission tomography ligands for peripheral-type benzodiazepine receptor in the brain. Bioorg Med Chem Lett19:1707-10 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50266862 |
---|
n/a |
---|
Name | BDBM50266862 |
Synonyms: | CHEMBL476607 | N-benzyl-2-(7-(2-fluoroethyl)-8-oxo-2-phenyl-7H-purin-9(8H)-yl)-N-methylacetamide |
Type | Small organic molecule |
Emp. Form. | C23H22FN5O2 |
Mol. Mass. | 419.4515 |
SMILES | CN(Cc1ccccc1)C(=O)Cn1c2nc(ncc2n(CCF)c1=O)-c1ccccc1 |
Structure |
|