Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50122294
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563774
Ki 0.08±n/a nM
Citation Yanamoto KKumata KYamasaki TOdawara CKawamura KYui JHatori ASuzuki KZhang MR [18F]FEAC and [18F]FEDAC: Two novel positron emission tomography ligands for peripheral-type benzodiazepine receptor in the brain. Bioorg Med Chem Lett 19:1707-10 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122294
n/a
NameBDBM50122294
Synonyms:CHEMBL292092 | N-(5-fluoro-2-phenoxyphenyl)-N-(2-(2-fluoroethoxy)-5-methoxybenzyl)acetamide | N-[2-(2-Fluoro-ethoxy)-5-methoxy-benzyl]-N-(5-fluoro-2-phenoxy-phenyl)-acetamide
TypeSmall organic molecule
Emp. Form.C24H23F2NO4
Mol. Mass.427.4405
SMILESCOc1ccc(OCCF)c(CN(C(C)=O)c2cc(F)ccc2Oc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: