Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50278263 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_564843 (CHEMBL955070) |
---|
Ki | 3.9±n/a nM |
---|
Citation | Wentland, MP; Lou, R; Lu, Q; Bu, Y; Denhardt, C; Jin, J; Ganorkar, R; VanAlstine, MA; Guo, C; Cohen, DJ; Bidlack, JM Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett19:2289-94 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50278263 |
---|
n/a |
---|
Name | BDBM50278263 |
Synonyms: | (1R,9R,10S,13R)-17-(cyclobutylmethyl)-3,10,13-trihydroxy-17-azatetracyclo[7.5.3.0^{1,10}.0^{2,7}]heptadeca-2(7),3,5-triene-4-carboxamide | CHEMBL511645 | US10231963, Table B.20 | US10287250, Compound B.14 | US10736890, Compound TABLE B.20 | US10752592, Compound TABLE B.14 | US11534436, Compound Table B.20 | US9133125, Table B, Compound 14 | US9656961, Example 00137 |
Type | Small organic molecule |
Emp. Form. | C22H30N2O4 |
Mol. Mass. | 386.4846 |
SMILES | NC(=O)c1ccc2C[C@H]3N(CC4CCC4)CC[C@@]4(C[C@H](O)CC[C@@]34O)c2c1O |r| |
Structure |
|