Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50005886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_523462
Ki>10000±n/a nM
Citation Baqi YAtzler KKöse MGlänzel MMüller CE High-affinity, non-nucleotide-derived competitive antagonists of platelet P2Y12 receptors. J Med Chem 52:3784-93 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:ADP-glucose receptor | ADPG-R | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | SP1999
Type:Enzyme
Mol. Mass.:39458.48
Organism:Homo sapiens (Human)
Description:Q9H244
Residue:342
Sequence:
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005886
n/a
NameBDBM50005886
Synonyms:1,8-Dihydroxy-3-methoxy-6-methylanthraquinone | 1,8-dihydroxy-3-methoxy-6-methylanthracene-9,10-dione | CHEMBL42624 | Physcione | physcion
TypeSmall organic molecule
Emp. Form.C16H12O5
Mol. Mass.284.2635
SMILESCOc1cc(O)c2C(=O)c3c(O)cc(C)cc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: