Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50259452
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501175
IC50 0.16±n/a nM
Citation Bezençon OBur DWeller TRichard-Bildstein SRemen LSifferlen TCorminboeuf OGrisostomi CBoss CPrade LDelahaye STreiber AStrickner PBinkert CHess PSteiner BFischli W Design and preparation of potent, nonpeptidic, bioavailable renin inhibitors. J Med Chem 52:3689-702 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259452
n/a
NameBDBM50259452
Synonyms:(1R,5S)-3-Acetyl-7-{4-[2-(2,6-dichloro-4-methyl-phenoxy)-ethoxy]-phenyl}-3,9-diaza-bicyclo-[3.3.1]non-6-ene-6-carboxylic acid cyclopropyl-(2,3-dichloro-benzyl)-amide | CHEMBL508205
TypeSmall organic molecule
Emp. Form.C35H35Cl4N3O4
Mol. Mass.703.482
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: