Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase LCK
LigandBDBM50248765
Substrate/Competitorn/a
Meas. Tech.ChEMBL_587115
IC50 750±n/a nM
Citation Bain JPlater LElliott MShpiro NHastie CJMcLauchlan HKlevernic IArthur JSAlessi DRCohen P The selectivity of protein kinase inhibitors: a further update. Biochem J 408:297-315 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase LCK
Name:Tyrosine-protein kinase LCK
Synonyms:LSK | Lymphocyte cell-specific protein-tyrosine kinase | Proto-oncogene tyrosine-protein kinase LCK | p56-LCK
Type:PROTEIN
Mol. Mass.:57927.84
Organism:Mus musculus
Description:ChEMBL_806408
Residue:509
Sequence:
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248765
n/a
NameBDBM50248765
Synonyms:1-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H-pyrrolo[2,3-d]pyrimidin-6-yl)-2-fluoroethanone | CHEMBL515414
TypeSmall organic molecule
Emp. Form.C18H19FN4O2
Mol. Mass.342.3675
SMILESCc1ccc(cc1)-c1c(C(=O)CF)n(CCCO)c2ncnc(N)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: