Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetc-Jun N-terminal kinase, JNK
LigandBDBM50229961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586375
IC50 620±n/a nM
Citation Bain JPlater LElliott MShpiro NHastie CJMcLauchlan HKlevernic IArthur JSAlessi DRCohen P The selectivity of protein kinase inhibitors: a further update. Biochem J 408:297-315 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
c-Jun N-terminal kinase, JNK
Name:c-Jun N-terminal kinase, JNK
Synonyms:JNK-46 | JNK1 | JNK1-alpha-1 | Mitogen-Activated Protein Kinase 8 (JNK1) | Stress-activated protein kinase JNK1 | c-Jun N-terminal kinase 1 | c-Jun N-terminal kinase 1 (JNK1) | c-Jun N-terminal kinase 1(JNK1) | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48297.57
Organism:Homo sapiens (Human)
Description:JNK-1 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:427
Sequence:
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229961
n/a
NameBDBM50229961
Synonyms:1-(1,1-dimethylethyl)-3-(1-naphthalenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 1-(tert-butyl)-3-(naphthalen-1-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4) | 1-NA-PP1 | 1-tert-butyl-3-(naphthalen-1-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4) | 1-tert-butyl-3-naphthalen-1-yl-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 4-Amino-1-tert-butyl-3-(1'-naphthyl)pyrazolo[3,4-d]pyrimidine | CHEMBL264406 | US9765037, Compound 1
TypeSmall organic molecule
Emp. Form.C19H19N5
Mol. Mass.317.3877
SMILESCC(C)(C)n1nc(-c2cccc3ccccc23)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: