Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform delta
LigandBDBM25116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586616
IC50 170±n/a nM
Citation Bain JPlater LElliott MShpiro NHastie CJMcLauchlan HKlevernic IArthur JSAlessi DRCohen P The selectivity of protein kinase inhibitors: a further update. Biochem J 408:297-315 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform delta
Name:Casein kinase I delta/epsilon
Synonyms:CKI-delta | CKId | CSNK1D | Casein kinase 1 delta (CK1δ) | Casein kinase I delta | Casein kinase I isoform delta (CK1D) | casein kinases 1 delta (CK1 delta)
Type:Enzyme
Mol. Mass.:47356.76
Organism:Homo sapiens (Human)
Description:P48730
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25116
n/a
NameBDBM25116
Synonyms:1-tert-butyl-3-(4-methylphenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL306380 | PP1 | cid_1400
TypeSmall organic molecule
Emp. Form.C16H19N5
Mol. Mass.281.3556
SMILESCc1ccc(cc1)-c1nn(c2ncnc(N)c12)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: