Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase RIPK2
LigandBDBM50095227
Substrate/Competitorn/a
Meas. Tech.ChEMBL_587119
IC50 26±n/a nM
Citation Bain JPlater LElliott MShpiro NHastie CJMcLauchlan HKlevernic IArthur JSAlessi DRCohen P The selectivity of protein kinase inhibitors: a further update. Biochem J 408:297-315 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase RIPK2
Name:Serine/threonine-protein kinase RIPK2
Synonyms:Tyrosine-protein kinase RIPK2 | receptor-interacting serine/threonine-protein kinase 2
Type:Protein
Mol. Mass.:61201.30
Organism:Homo sapiens (Human)
Description:n/a
Residue:540
Sequence:
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095227
n/a
NameBDBM50095227
Synonyms:(6,7-Dimethoxy-quinazolin-4-yl)-(4-phenoxy-phenyl)-amine | 6,7-dimethoxy-N-(4-phenoxyphenyl)quinazolin-4-amine | CHEMBL97771
TypeSmall organic molecule
Emp. Form.C22H19N3O3
Mol. Mass.373.4046
SMILESCOc1cc2ncnc(Nc3ccc(Oc4ccccc4)cc3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: