Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM25116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586868
IC50 53±n/a nM
Citation Bain JPlater LElliott MShpiro NHastie CJMcLauchlan HKlevernic IArthur JSAlessi DRCohen P The selectivity of protein kinase inhibitors: a further update. Biochem J 408:297-315 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Tyrosine-protein kinase SRC | c-Src | p60-Src | p60c-src | pp60c-src
Type:Tyr protein kinase
Mol. Mass.:60015.36
Organism:Gallus gallus (Chicken)
Description:P00523
Residue:533
Sequence:
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYR
MPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25116
n/a
NameBDBM25116
Synonyms:1-tert-butyl-3-(4-methylphenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL306380 | PP1 | cid_1400
TypeSmall organic molecule
Emp. Form.C16H19N5
Mol. Mass.281.3556
SMILESCc1ccc(cc1)-c1nn(c2ncnc(N)c12)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: