Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-dependent protein kinase
LigandBDBM13216
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586712
Kd>1±n/a nM
Citation Karaman MWHerrgard STreiber DKGallant PAtteridge CECampbell BTChan KWCiceri PDavis MIEdeen PTFaraoni RFloyd MHunt JPLockhart DJMilanov ZVMorrison MJPallares GPatel HKPritchard SWodicka LMZarrinkar PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol 26:127-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cGMP-dependent protein kinase
Name:cGMP-dependent protein kinase 1 beta
Synonyms:GMP-dependent protein kinase I | Protein Kinase G | cGMP-dependent protein kinase 1
Type:Protein
Mol. Mass.:76358.04
Organism:Homo sapiens (Human)
Description:Q13976
Residue:671
Sequence:
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13216
n/a
NameBDBM13216
Synonyms:BMS-354825 | CHEMBL1421 | DASATINIB | N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl)]-2-methyl-4-pyrimidinyl]amino)]-1,3-thiazole-5-carboxamide | N-(2-chloro-6-methylphenyl)-2-({6-[4-(2-hydroxyethyl)piperazin-1-yl]-2-methylpyrimidin-4-yl}amino)-1,3-thiazole-5-carboxamide | cid_3062316
TypeSmall organic molecule
Emp. Form.C22H26ClN7O2S
Mol. Mass.488.006
SMILESCc1nc(Nc2ncc(s2)C(=O)Nc2c(C)cccc2Cl)cc(n1)N1CCN(CCO)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: