Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform delta
LigandBDBM5655
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586690
Kd>10000±n/a nM
Citation Karaman MWHerrgard STreiber DKGallant PAtteridge CECampbell BTChan KWCiceri PDavis MIEdeen PTFaraoni RFloyd MHunt JPLockhart DJMilanov ZVMorrison MJPallares GPatel HKPritchard SWodicka LMZarrinkar PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol 26:127-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform delta
Name:Casein kinase I delta/epsilon
Synonyms:CKI-delta | CKId | CSNK1D | Casein kinase 1 delta (CK1δ) | Casein kinase I delta | Casein kinase I isoform delta (CK1D) | casein kinases 1 delta (CK1 delta)
Type:Enzyme
Mol. Mass.:47356.76
Organism:Homo sapiens (Human)
Description:P48730
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5655
n/a
NameBDBM5655
Synonyms:2-(2-chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydroxy-1-methylpiperidin-4-yl]-4H-chromen-4-one | CHEMBL428690 | Flavopiridol | US9617225, Flavopiridol
TypeSmall organic molecule
Emp. Form.C21H20ClNO5
Mol. Mass.401.84
SMILESCN1CC[C@@H]([C@H](O)C1)c1c(O)cc(O)c2c1oc(cc2=O)-c1ccccc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: