| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity mitogen-activated protein kinase kinase 3 |
|---|
| Ligand | BDBM26474 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_587188 (CHEMBL1060250) |
|---|
| Kd | >10000±n/a nM |
|---|
| Citation |  Karaman, MW; Herrgard, S; Treiber, DK; Gallant, P; Atteridge, CE; Campbell, BT; Chan, KW; Ciceri, P; Davis, MI; Edeen, PT; Faraoni, R; Floyd, M; Hunt, JP; Lockhart, DJ; Milanov, ZV; Morrison, MJ; Pallares, G; Patel, HK; Pritchard, S; Wodicka, LM; Zarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity mitogen-activated protein kinase kinase 3 |
|---|
| Name: | Dual specificity mitogen-activated protein kinase kinase 3 |
|---|
| Synonyms: | Dual specificity mitogen-activated protein kinase kinase 3 | MAP kinase kinase 3 | MAP2K3 | MAPK/ERK kinase 3 | MAPK/ERK kinase 3 (MEK3) | MAPKK 3 | MEK3 | MKK3 | MP2K3_HUMAN | PRKMK3 | SKK2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39321.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 347 |
|---|
| Sequence: | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
|
|
|
|---|
| BDBM26474 |
|---|
| n/a |
|---|
| Name | BDBM26474 |
|---|
| Synonyms: | 5-({4-[(2,3-dimethyl-2H-indazol-6-yl)(methyl)amino]pyrimidin-2-yl}amino)-2-methylbenzene-1-sulfonamide | GW-786034 | JMC514632 Compound 13 | Pazopanib | cid_10113978 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23N7O2S |
|---|
| Mol. Mass. | 437.518 |
|---|
| SMILES | CN(c1ccc2c(C)n(C)nc2c1)c1ccnc(Nc2ccc(C)c(c2)S(N)(=O)=O)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
