Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 15
LigandBDBM10888
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592895
Ki 634±n/a nM
Citation Temperini CInnocenti AScozzafava AParkkila SSupuran CT The coumarin-binding site in carbonic anhydrase accommodates structurally diverse inhibitors: the antiepileptic lacosamide as an example and lead molecule for novel classes of carbonic anhydrase inhibitors. J Med Chem 53:850-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 15
Name:Carbonic anhydrase 15
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35484.02
Organism:Mus musculus
Description:ChEMBL_651955
Residue:324
Sequence:
MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRL
VQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQ
LHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDR
DNTNFSAIVSGLKNLSSPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVL
WTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSS
VSTLPCLHLALVGLGVGLRLWQGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10888
n/a
NameBDBM10888
Synonyms:1,2-benzoxazol-3-ylmethanesulfonamide | CHEMBL750 | SPR_2 | US10172837, Zonisamide | Zonisamide | Zonisamide (ZNA) | Zonisamide (ZNS) | Zonisamide, 1 | Zonisamide, ZNS
TypeSmall organic molecule
Emp. Form.C8H8N2O3S
Mol. Mass.212.226
SMILESNS(=O)(=O)Cc1noc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: