Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM50300204
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592885
Ki 374±n/a nM
Citation Temperini CInnocenti AScozzafava AParkkila SSupuran CT The coumarin-binding site in carbonic anhydrase accommodates structurally diverse inhibitors: the antiepileptic lacosamide as an example and lead molecule for novel classes of carbonic anhydrase inhibitors. J Med Chem 53:850-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300204
n/a
NameBDBM50300204
Synonyms:(2R)-2-acetylamino-N-benzyl-3-methoxypropanamide | (R)-2-Acetylamino-N-benzyl-3-methoxy-propionamide | (R)-2-acetamido-N-benzyl-3-methoxypropanamide | (R)-N-benzyl 2-acetamido-3-methoxypropionamide | (R)-N-benzyl 2-acetamido-3-methoxypropionamide, | CHEMBL58323 | Erlosamide | LACOSAMIDE
TypeSmall organic molecule
Emp. Form.C13H18N2O3
Mol. Mass.250.2936
SMILESCOC[C@@H](NC(C)=O)C(=O)NCc1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: