Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor
LigandBDBM50301704
Substrate/Competitorn/a
Meas. Tech.ChEMBL_597858
IC50 0.22±n/a nM
Citation Suzuki TKameda MAndo MMiyazoe HSekino EIto SMasutani KKamijo KTakezawa AMoriya MIto MIto JNakase KMatsushita HIshihara ATakenaga NTokita SKanatani ASato NFukami T Discovery of novel diarylketoxime derivatives as selective and orally active melanin-concentrating hormone 1 receptor antagonists. Bioorg Med Chem Lett 19:5339-45 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor
Name:Melanin-concentrating hormone receptor
Synonyms:G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | Somatostatin receptor-like protein
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45976.27
Organism:Homo sapiens (Human)
Description:Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays.
Residue:422
Sequence:
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50301704
n/a
NameBDBM50301704
Synonyms:(Z)-(3,4-difluorophenyl)(4-((6-fluoro-1H-spiro[furo[3,4-c]pyridine-3,4'-piperidine]-1'-yl)methyl)phenyl)methanone O-methyl oxime | CHEMBL566880
TypeSmall organic molecule
Emp. Form.C26H24F3N3O2
Mol. Mass.467.4829
SMILESCO\N=C(\c1ccc(CN2CCC3(CC2)OCc2cc(F)ncc32)cc1)c1ccc(F)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: