Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyrimidinergic receptor P2Y6
LigandBDBM50209663
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595742
EC50>10000±n/a nM
Citation Das AKo HBurianek LEBarrett MOHarden TKJacobson KA Human P2Y(14) receptor agonists: truncation of the hexose moiety of uridine-5'-diphosphoglucose and its replacement with alkyl and aryl groups. J Med Chem 53:471-80 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyrimidinergic receptor P2Y6
Name:Pyrimidinergic receptor P2Y6
Synonyms:P2Y purinoceptor 6 | P2Y6
Type:PROTEIN
Mol. Mass.:36452.29
Organism:Homo sapiens (Human)
Description:ChEMBL_1511151
Residue:328
Sequence:
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209663
n/a
NameBDBM50209663
Synonyms:CHEMBL374384 | MRS-2670 | diphosphoric acid 1-alpha-D-glucopyranosyl ester 2-((4'-thio)uridin-5''-yl) ester
TypeSmall organic molecule
Emp. Form.C15H24N2O16P2S
Mol. Mass.582.367
SMILESOC[C@H]1O[C@H](OP(O)(=O)OP(O)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2ccc(=S)[nH]c2=O)[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: