Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIV
LigandBDBM50303489
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595960
Ki 3200±n/a nM
Citation Maresca ATemperini CPochet LMasereel BScozzafava ASupuran CT Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem 53:335-44 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIV
Name:Carbonic Anhydrase XIV
Synonyms:CA-XIV | Carbonate dehydratase XIV | Carbonic anhydrase 14 | Carbonic anhydrase 14 (CA XIV) | Carbonic anhydrase XIV (CA XIV)
Type:Enzyme
Mol. Mass.:37665.67
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme.
Residue:337
Sequence:
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303489
n/a
NameBDBM50303489
Synonyms:6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | CHEMBL568416
TypeSmall organic molecule
Emp. Form.C11H8O5
Mol. Mass.220.1782
SMILESCOc1ccc2oc(=O)c(cc2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: