Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 15
LigandBDBM50303497
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595961
Ki 7100±n/a nM
Citation Maresca ATemperini CPochet LMasereel BScozzafava ASupuran CT Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem 53:335-44 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 15
Name:Carbonic anhydrase 15
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35484.02
Organism:Mus musculus
Description:ChEMBL_651955
Residue:324
Sequence:
MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRL
VQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQ
LHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDR
DNTNFSAIVSGLKNLSSPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVL
WTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSS
VSTLPCLHLALVGLGVGLRLWQGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303497
n/a
NameBDBM50303497
Synonyms:6-(aminomethyl)-2H-chromen-2-one | CHEMBL567139
TypeSmall organic molecule
Emp. Form.C10H9NO2
Mol. Mass.175.184
SMILESNCc1ccc2oc(=O)ccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: