Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6 (CA-VI)
LigandBDBM50303498
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595955
Ki 100±n/a nM
Citation Maresca ATemperini CPochet LMasereel BScozzafava ASupuran CT Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem 53:335-44 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 6 (CA-VI)
Name:Carbonic anhydrase 6 (CA-VI)
Synonyms:CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:Enzyme
Mol. Mass.:35371.40
Organism:Homo sapiens (Human)
Description:P23280
Residue:308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303498
n/a
NameBDBM50303498
Synonyms:1-(2-Oxo-2H-chromen-6-ylmethyl)-3,5,7-triaza-1-azonia-tricyclo[3.3.1.1*3,7*]decane | CHEMBL578167
TypeSmall organic molecule
Emp. Form.C16H19N4O2
Mol. Mass.299.3471
SMILESO=c1ccc2cc(C[N+]34CN5CN(CN(C5)C3)C4)ccc2o1 |TLB:15:14:17:10.9.11,15:10:17:14.16.13,THB:9:8:10.11.15:13,9:10:8.16.17:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: