Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VA
LigandBDBM50022188
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595953
Ki 3300±n/a nM
Citation Maresca ATemperini CPochet LMasereel BScozzafava ASupuran CT Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem 53:335-44 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VA
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022188
n/a
NameBDBM50022188
Synonyms:7-Methoxy-2-oxo-2H-chromene-4-carboxylic acid | CHEMBL12567
TypeSmall organic molecule
Emp. Form.C11H8O5
Mol. Mass.220.1782
SMILESCOc1ccc2c(cc(=O)oc2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: