Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPteridine reductase 1
LigandBDBM50303509
Substrate/Competitorn/a
Meas. Tech.ChEMBL_596055
Ki>27000±n/a nM
Citation Tulloch LBMartini VPIulek JHuggan JKLee JHGibson CLSmith TKSuckling CJHunter WN Structure-based design of pteridine reductase inhibitors targeting African sleeping sickness and the leishmaniases. J Med Chem 53:221-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pteridine reductase 1
Name:Pteridine reductase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30459.34
Organism:Leishmania major
Description:ChEMBL_1470027
Residue:288
Sequence:
MTAPTVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAI
TVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLR
NDEDGHEPCVGDREAMETATADLFGSNAIAPYFLIKAFAHRFAGTPAKHRGTNYSIINMV
DAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEG
HRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303509
n/a
NameBDBM50303509
Synonyms:2-amino-6-bromo-4-oxo-4,7-dihydro-3H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile | CHEMBL567352
TypeSmall organic molecule
Emp. Form.C7H4BrN5O
Mol. Mass.254.044
SMILESNc1nc2[nH]c(Br)c(C#N)c2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: