| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pteridine reductase 1 |
|---|
| Ligand | BDBM50303518 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_596055 (CHEMBL1037349) |
|---|
| Ki | 600±n/a nM |
|---|
| Citation |  Tulloch, LB; Martini, VP; Iulek, J; Huggan, JK; Lee, JH; Gibson, CL; Smith, TK; Suckling, CJ; Hunter, WN Structure-based design of pteridine reductase inhibitors targeting African sleeping sickness and the leishmaniases. J Med Chem53:221-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Pteridine reductase 1 |
|---|
| Name: | Pteridine reductase 1 |
|---|
| Synonyms: | HMTXR | PTR1 | PTR1_LEIMA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30459.34 |
|---|
| Organism: | Leishmania major |
|---|
| Description: | ChEMBL_1470027 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MTAPTVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAI
TVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLR
NDEDGHEPCVGDREAMETATADLFGSNAIAPYFLIKAFAHRFAGTPAKHRGTNYSIINMV
DAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEG
HRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
|
|
|
|---|
| BDBM50303518 |
|---|
| n/a |
|---|
| Name | BDBM50303518 |
|---|
| Synonyms: | 2,4-diamino-6-(benzylthio)pyrimidin-1-ium | 6-(benzylsulfanyl)pyrimidine-2,4-diamine | CHEMBL566948 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H12N4S |
|---|
| Mol. Mass. | 232.305 |
|---|
| SMILES | Nc1cc(SCc2ccccc2)nc(N)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
