Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM50304001
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595424
Ki 5±n/a nM
Citation de la Fuente TMartín-Fontecha MSallander JBenhamú BCampillo MMedina RAPellissier LPClaeysen SDumuis APardo LLópez-Rodríguez ML Benzimidazole derivatives as new serotonin 5-HT6 receptor antagonists. Molecular mechanisms of receptor inactivation. J Med Chem 53:1357-69 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304001
n/a
NameBDBM50304001
Synonyms:CHEMBL584690 | [4-(4-Methylpiperazin-1-yl)-1H-benzimidazol-2-yl](1-naphthyl)methanone
TypeSmall organic molecule
Emp. Form.C23H22N4O
Mol. Mass.370.447
SMILESCN1CCN(CC1)c1cccc2[nH]c(nc12)C(=O)c1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: