Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalanin receptor 2
LigandBDBM50307258
Substrate/Competitorn/a
Meas. Tech.ChEMBL_610350
Ki 16±n/a nM
Citation Robertson CRScholl EAPruess THGreen BRWhite HSBulaj G Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. J Med Chem 53:1871-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Galanin receptor 2
Name:Galanin receptor 2
Synonyms:GALR2 | Galanin R2 | Galanin receptor 2 | Galanin receptor type 2 | Galanin receptor type 2 (GAL2-R) (GALR2).
Type:Enzyme Catalytic Domain
Mol. Mass.:41724.40
Organism:Homo sapiens (Human)
Description:Galanin R2 GALR2 HUMAN::O43603
Residue:387
Sequence:
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307258
n/a
NameBDBM50307258
Synonyms:CHEMBL578317 | [N-Ac,des-Sar]Gal-B2
TypeSmall organic molecule
Emp. Form.C103H171N23O22
Mol. Mass.2083.6007
SMILESCCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(C)=O)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: