Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcto-5'-nucleotidase (e5'NT)
LigandBDBM7460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612633
Ki 45.3±n/a nM
Citation Baqi YLee SYIqbal JRipphausen PLehr AScheiff ABZimmermann HBajorath JMüller CE Development of potent and selective inhibitors of ecto-5'-nucleotidase based on an anthraquinone scaffold. J Med Chem 53:2076-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecto-5'-nucleotidase (e5'NT)
Name:Ecto-5'-nucleotidase (e5'NT)
Synonyms:5'-nucleotidase | Ecto-5-nucleotidase (e5'NT) | NT
Type:Enzyme
Mol. Mass.:63971.44
Organism:Rattus norvegicus (Rat)
Description:P21588
Residue:576
Sequence:
MRPAAATAPKWLLLALSALLPLWPTAKSWELTIMHTNDVHSRLEQTSDDSTKCLNASLCV
GGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNH
EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTS
KETPFLSNPGTNLVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDV
VVGGHTNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKG
NVVTSYGNPILLNSTIREDAAIKADINQWRIKLDNYSTQELGRTIVYLNGSAQECRFREC
NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDERNNGTITWENLAAVLPFG
GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDISRKPWDRVVQLKVLCTK
CRVPIYEPLEMDKVYKVVLPSYLVNGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVI
YPAVEGRIKFSAASHYQGSFPLIILSFWAVILVLYQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7460
n/a
NameBDBM7460
Synonyms:2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US9180183, Quercetin
TypeSmall organic molecule
Emp. Form.C15H10O7
Mol. Mass.302.2357
SMILESOc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: