Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyrimidinergic receptor P2Y6
LigandBDBM50227032
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612835
IC50>10000±n/a nM
Citation Baqi YLee SYIqbal JRipphausen PLehr AScheiff ABZimmermann HBajorath JMüller CE Development of potent and selective inhibitors of ecto-5'-nucleotidase based on an anthraquinone scaffold. J Med Chem 53:2076-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyrimidinergic receptor P2Y6
Name:Pyrimidinergic receptor P2Y6
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36704.21
Organism:Rattus norvegicus
Description:ChEMBL_805344
Residue:328
Sequence:
MERDNGTIQAPGLPPTTCVYREDFKRLLLPPVYSVVLVVGLPLNVCVIAQICASRRTLTR
SAVYTLNLALADLLYACSLPLLIYNYARGDHWPFGDLACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWVVCGVVWLVVTAQCLPTAVFAATGIQRNRTVCYDL
SPPILSTRYLPYGMALTVIGFLLPFTALLACYCRMARRLCRQDGPAGPVAQERRSKAARM
AVVVAAVFVISFLPFHITKTAYLAVRSTPGVSCPVLETFAAAYKGTRPFASANSVLDPIL
FYFTQQKFRRQPHDLLQKLTAKWQRQRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227032
n/a
NameBDBM50227032
Synonyms:CHEMBL256057 | acid blue 25 | sodium 1-amino-9,10-dioxo-4-(phenylamino)-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C20H13N2O5S
Mol. Mass.393.393
SMILESNc1c2C(=O)c3ccccc3C(=O)c2c(Nc2ccccc2)cc1S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: