Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEctonucleoside triphosphate diphosphohydrolase 2
LigandBDBM50307835
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612640
Ki>200000±n/a nM
Citation Baqi YLee SYIqbal JRipphausen PLehr AScheiff ABZimmermann HBajorath JMüller CE Development of potent and selective inhibitors of ecto-5'-nucleotidase based on an anthraquinone scaffold. J Med Chem 53:2076-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ectonucleoside triphosphate diphosphohydrolase 2
Name:Ectonucleoside triphosphate diphosphohydrolase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53675.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1453714
Residue:495
Sequence:
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAF
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALV
LLLRQVHSAKLPSTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307835
n/a
NameBDBM50307835
Synonyms:CHEMBL590956 | Sodium 1-amino-4-[4-fluoro-2-carboxyphenylamino]-9,10-dioxo-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C21H12FN2O7S
Mol. Mass.455.393
SMILESNc1c(cc(Nc2ccc(F)cc2C(O)=O)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: