| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cell division control protein 42 homolog |
|---|
| Ligand | BDBM50308866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_607696 (CHEMBL1066161) |
|---|
| IC50 | >5000±n/a nM |
|---|
| Citation |  Morwick, T; Büttner, FH; Cywin, CL; Dahmann, G; Hickey, E; Jakes, S; Kaplita, P; Kashem, MA; Kerr, S; Kugler, S; Mao, W; Marshall, D; Paw, Z; Shih, CK; Wu, F; Young, E Hit to lead account of the discovery of bisbenzamide and related ureidobenzamide inhibitors of Rho kinase. J Med Chem53:759-77 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cell division control protein 42 homolog |
|---|
| Name: | Cell division control protein 42 homolog |
|---|
| Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21258.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_652970 |
|---|
| Residue: | 191 |
|---|
| Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
|---|
| BDBM50308866 |
|---|
| n/a |
|---|
| Name | BDBM50308866 |
|---|
| Synonyms: | 3-Chloro-N-[3-(4-dimethylaminomethyl-phenylcarbamoyl)-benzyl]-4-methoxy-benzamide | CHEMBL592709 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26ClN3O3 |
|---|
| Mol. Mass. | 451.945 |
|---|
| SMILES | COc1ccc(cc1Cl)C(=O)NCc1cccc(c1)C(=O)Nc1ccc(CN(C)C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
