Reaction Details |
| Report a problem with these data |
Target | Cell division control protein 42 homolog |
---|
Ligand | BDBM50308866 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_607696 (CHEMBL1066161) |
---|
IC50 | >5000±n/a nM |
---|
Citation | Morwick, T; Büttner, FH; Cywin, CL; Dahmann, G; Hickey, E; Jakes, S; Kaplita, P; Kashem, MA; Kerr, S; Kugler, S; Mao, W; Marshall, D; Paw, Z; Shih, CK; Wu, F; Young, E Hit to lead account of the discovery of bisbenzamide and related ureidobenzamide inhibitors of Rho kinase. J Med Chem53:759-77 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cell division control protein 42 homolog |
---|
Name: | Cell division control protein 42 homolog |
Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
Type: | PROTEIN |
Mol. Mass.: | 21258.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_652970 |
Residue: | 191 |
Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
BDBM50308866 |
---|
n/a |
---|
Name | BDBM50308866 |
Synonyms: | 3-Chloro-N-[3-(4-dimethylaminomethyl-phenylcarbamoyl)-benzyl]-4-methoxy-benzamide | CHEMBL592709 |
Type | Small organic molecule |
Emp. Form. | C25H26ClN3O3 |
Mol. Mass. | 451.945 |
SMILES | COc1ccc(cc1Cl)C(=O)NCc1cccc(c1)C(=O)Nc1ccc(CN(C)C)cc1 |
Structure |
|