| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM22032 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_612729 (CHEMBL1069601) |
|---|
| Ki | 9.8±n/a nM |
|---|
| Citation |  Stevenson, L; Tavares, AA; Brunet, A; McGonagle, FI; Dewar, D; Pimlott, SL; Sutherland, A New iodinated quinoline-2-carboxamides for SPECT imaging of the translocator protein. Bioorg Med Chem Lett20:954-7 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM22032 |
|---|
| n/a |
|---|
| Name | BDBM22032 |
|---|
| Synonyms: | 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide | CHEMBL15313 | N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | PK 11195 | PK-11195 | PK11195 | RP 52028 | [3H]PK 11195 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C21H21ClN2O |
|---|
| Mol. Mass. | 352.857 |
|---|
| SMILES | CCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
