Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PLK1
LigandBDBM50314075
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627201
IC50 720±n/a nM
Citation Zuccotto FArdini ECasale EAngiolini M Through the"gatekeeper door": exploiting the active kinase conformation. J Med Chem 53:2681-94 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PLK1
Name:Serine/threonine-protein kinase PLK1
Synonyms:PLK-1 | PLK1 | Polo-like kinase 1 (PlK1) | Polo-like kinase 1 (Plk-1) | STPK13 | Serine/threonine-protein kinase (PLK1) | Serine/threonine-protein kinase 13 | polo-like kinase
Type:Serine/threonine-protein kinase
Mol. Mass.:68277.16
Organism:Homo sapiens (Human)
Description:P53350
Residue:603
Sequence:
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314075
n/a
NameBDBM50314075
Synonyms:1-(5-(2-(6-(1H-1,2,4-triazol-3-ylamino)pyrimidin-4-ylamino)ethyl)thiazol-2-yl)-3-(5-methyl-2-(trifluoromethyl)furan-3-yl)urea | 1-[5-methyl-2-(trifluoromethyl)furan-3-yl]-3-[(2Z)-5-(2-{[6-(1H-1,2,4-triazol-3-ylamino)pyrimidin-4-yl]amino}ethyl)-1,3-thiazol-2(3H)-ylidene]urea | CHEMBL1092830
TypeSmall organic molecule
Emp. Form.C18H17F3N10O2S
Mol. Mass.494.454
SMILESCc1cc(NC(=O)Nc2ncc(CCNc3cc(Nc4nnc[nH]4)ncn3)s2)c(o1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: