Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50008984 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_627498 (CHEMBL1111784) |
---|
Ki | 568±n/a nM |
---|
Citation | Weltrowska, G; Chung, NN; Lemieux, C; Guo, J; Lu, Y; Wilkes, BC; Schiller, PW "Carba"-analogues of fentanyl are opioid receptor agonists. J Med Chem53:2875-81 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50008984 |
---|
n/a |
---|
Name | BDBM50008984 |
Synonyms: | 4-(4-Chloro-benzyl)-2-(1-methyl-azepan-4-yl)-2H-phthalazin-1-one | CHEMBL596 | Duragesic-100 | Duragesic-12 | Duragesic-25 | Duragesic-50 | Duragesic-75 | FENTANYL | FENTANYL CITRATE | FENTANYL-HCl | Fentanyl-100 | Fentanyl-12 | Fentanyl-25 | Fentanyl-50 | Fentanyl-75 | Fentora | Innovar | Ionsys | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide(Fentanyl) | N-(1-phenethylpiperidin-4-yl)-N-phenylpropionamide | US20230399418, Compound Fentanyl |
Type | Small organic molecule |
Emp. Form. | C22H28N2O |
Mol. Mass. | 336.4705 |
SMILES | CCC(=O)N(C1CCN(CCc2ccccc2)CC1)c1ccccc1 |
Structure |
|