| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H4 receptor |
|---|
| Ligand | BDBM50315323 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_625971 (CHEMBL1103490) |
|---|
| IC50 | 41±n/a nM |
|---|
| Citation |  Cramp, S; Dyke, HJ; Higgs, C; Clark, DE; Gill, M; Savy, P; Jennings, N; Price, S; Lockey, PM; Norman, D; Porres, S; Wilson, F; Jones, A; Ramsden, N; Mangano, R; Leggate, D; Andersson, M; Hale, R Identification and hit-to-lead exploration of a novel series of histamine H4 receptor inverse agonists. Bioorg Med Chem Lett20:2516-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H4 receptor |
|---|
| Name: | Histamine H4 receptor |
|---|
| Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44517.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
|---|
| Residue: | 390 |
|---|
| Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
|---|
| BDBM50315323 |
|---|
| n/a |
|---|
| Name | BDBM50315323 |
|---|
| Synonyms: | (R)-1-(8-chlorobenzofuro[3,2-d]pyrimidin-4-yl)-N-methylpyrrolidin-3-amine | CHEMBL1090190 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15ClN4O |
|---|
| Mol. Mass. | 302.759 |
|---|
| SMILES | CN[C@@H]1CCN(C1)c1ncnc2c3cc(Cl)ccc3oc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
