Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM50315342 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_625971 (CHEMBL1103490) |
---|
IC50 | 39±n/a nM |
---|
Citation | Cramp, S; Dyke, HJ; Higgs, C; Clark, DE; Gill, M; Savy, P; Jennings, N; Price, S; Lockey, PM; Norman, D; Porres, S; Wilson, F; Jones, A; Ramsden, N; Mangano, R; Leggate, D; Andersson, M; Hale, R Identification and hit-to-lead exploration of a novel series of histamine H4 receptor inverse agonists. Bioorg Med Chem Lett20:2516-9 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM50315342 |
---|
n/a |
---|
Name | BDBM50315342 |
Synonyms: | 8-chloro-4-(4-methylpiperazin-1-yl)-2-(trifluoromethyl)benzofuro[3,2-d]pyrimidine | CHEMBL1092542 |
Type | Small organic molecule |
Emp. Form. | C16H14ClF3N4O |
Mol. Mass. | 370.757 |
SMILES | CN1CCN(CC1)c1nc(nc2c3cc(Cl)ccc3oc12)C(F)(F)F |
Structure |
|