| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 3 |
|---|
| Ligand | BDBM50315675 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_624017 (CHEMBL1116903) |
|---|
| EC50 | 71±n/a nM |
|---|
| Citation |  Lansdell, MI; Hepworth, D; Calabrese, A; Brown, AD; Blagg, J; Burring, DJ; Wilson, P; Fradet, D; Brown, TB; Quinton, F; Mistry, N; Tang, K; Mount, N; Stacey, P; Edmunds, N; Adams, C; Gaboardi, S; Neal-Morgan, S; Wayman, C; Cole, S; Phipps, J; Lewis, M; Verrier, H; Gillon, V; Feeder, N; Heatherington, A; Sultana, S; Haughie, S; Martin, SW; Sudworth, M; Tweedy, S Discovery of a selective small-molecule melanocortin-4 receptor agonist with efficacy in a pilot study of sexual dysfunction in humans. J Med Chem53:3183-97 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 3 |
|---|
| Name: | Melanocortin receptor 3 |
|---|
| Synonyms: | MC3-R | MC3R | MC3R_HUMAN | Melanocortin MC3 | Melanocortin receptor (M3 and M4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36044.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41968 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
|
|
|
|---|
| BDBM50315675 |
|---|
| n/a |
|---|
| Name | BDBM50315675 |
|---|
| Synonyms: | ((3R,4S)-4-(2,4-difluorophenyl)-1-(pyridin-2-yl)pyrrolidin-3-yl)((3S,4S,5R)-4-hydroxy-3,5-dimethyl-4-phenylpiperidin-1-yl)methanone | CHEMBL1089103 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H31F2N3O2 |
|---|
| Mol. Mass. | 491.5721 |
|---|
| SMILES | C[C@H]1CN(C[C@@H](C)[C@]1(O)c1ccccc1)C(=O)[C@H]1CN(C[C@@H]1c1ccc(F)cc1F)c1ccccn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
