Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50315668
Substrate/Competitorn/a
Meas. Tech.ChEMBL_624020
EC50>11100±n/a nM
Citation Lansdell MIHepworth DCalabrese ABrown ADBlagg JBurring DJWilson PFradet DBrown TBQuinton FMistry NTang KMount NStacey PEdmunds NAdams CGaboardi SNeal-Morgan SWayman CCole SPhipps JLewis MVerrier HGillon VFeeder NHeatherington ASultana SHaughie SMartin SWSudworth MTweedy S Discovery of a selective small-molecule melanocortin-4 receptor agonist with efficacy in a pilot study of sexual dysfunction in humans. J Med Chem 53:3183-97 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315668
n/a
NameBDBM50315668
Synonyms:((3R,4S)-4-(2,4-difluorophenyl)-1-(pyrimidin-2-yl)pyrrolidin-3-yl)((3S,4S,5R)-4-hydroxy-3,5-dimethyl-4-phenylpiperidin-1-yl)methanone | CHEMBL1089485
TypeSmall organic molecule
Emp. Form.C28H30F2N4O2
Mol. Mass.492.5602
SMILESC[C@H]1CN(C[C@@H](C)[C@]1(O)c1ccccc1)C(=O)[C@H]1CN(C[C@@H]1c1ccc(F)cc1F)c1ncccn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: