Reaction Details |
| Report a problem with these data |
Target | Melanocyte-stimulating hormone receptor |
---|
Ligand | BDBM50378748 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_624018 (CHEMBL1116904) |
---|
EC50 | 3900±n/a nM |
---|
Citation | Lansdell, MI; Hepworth, D; Calabrese, A; Brown, AD; Blagg, J; Burring, DJ; Wilson, P; Fradet, D; Brown, TB; Quinton, F; Mistry, N; Tang, K; Mount, N; Stacey, P; Edmunds, N; Adams, C; Gaboardi, S; Neal-Morgan, S; Wayman, C; Cole, S; Phipps, J; Lewis, M; Verrier, H; Gillon, V; Feeder, N; Heatherington, A; Sultana, S; Haughie, S; Martin, SW; Sudworth, M; Tweedy, S Discovery of a selective small-molecule melanocortin-4 receptor agonist with efficacy in a pilot study of sexual dysfunction in humans. J Med Chem53:3183-97 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocyte-stimulating hormone receptor |
---|
Name: | Melanocyte-stimulating hormone receptor |
Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
Type: | Enzyme |
Mol. Mass.: | 34717.23 |
Organism: | Homo sapiens (Human) |
Description: | Q01726 |
Residue: | 317 |
Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
BDBM50378748 |
---|
n/a |
---|
Name | BDBM50378748 |
Synonyms: | CHEMBL1204054 |
Type | Small organic molecule |
Emp. Form. | C25H32F2N4O2 |
Mol. Mass. | 458.544 |
SMILES | CCC[C@]1(O)[C@@H](C)CN(C[C@H]1C)C(=O)[C@H]1CN(C[C@@H]1c1ccc(F)cc1F)c1cccnn1 |r| |
Structure |
|