Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocyte-stimulating hormone receptor
LigandBDBM50378743
Substrate/Competitorn/a
Meas. Tech.ChEMBL_624018
EC50 1120±n/a nM
Citation Lansdell MIHepworth DCalabrese ABrown ADBlagg JBurring DJWilson PFradet DBrown TBQuinton FMistry NTang KMount NStacey PEdmunds NAdams CGaboardi SNeal-Morgan SWayman CCole SPhipps JLewis MVerrier HGillon VFeeder NHeatherington ASultana SHaughie SMartin SWSudworth MTweedy S Discovery of a selective small-molecule melanocortin-4 receptor agonist with efficacy in a pilot study of sexual dysfunction in humans. J Med Chem 53:3183-97 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocyte-stimulating hormone receptor
Name:Melanocortin receptor (M1 and M4)
Synonyms:MC1-R | MSH-R | Melanocortin MC1 | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R)
Type:Enzyme
Mol. Mass.:34717.23
Organism:Homo sapiens (Human)
Description:Q01726
Residue:317
Sequence:
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50378743
n/a
NameBDBM50378743
Synonyms:CHEMBL1204061
TypeSmall organic molecule
Emp. Form.C28H35F3N2O2
Mol. Mass.488.5849
SMILESC[C@H]1CN(C[C@@H](C)[C@]1(O)c1ccc(F)cc1)C(=O)[C@@H]1CN(C[C@H]1c1ccc(F)cc1F)C(C)(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: