Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 15-lipoxygenase
LigandBDBM22372
Substrate/Competitorn/a
Meas. Tech.ChEMBL_636733
IC50 1100±n/a nM
Citation Robinson SJHoobler EKRiener MLoveridge STTenney KValeriote FAHolman TRCrews P Using enzyme assays to evaluate the structure and bioactivity of sponge-derived meroterpenes. J Nat Prod 72:1857-63 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 15-lipoxygenase
Name:Arachidonate 15-lipoxygenase
Synonyms:15-Lipoxygenase-1 (15-LOX-1) | Arachidonate 15-lipoxygenase-1 | Reticulocyte 15-lipoxygenase-1
Type:Protein
Mol. Mass.:74804.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:662
Sequence:
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22372
n/a
NameBDBM22372
Synonyms:4-[(2R,3S)-4-(3,4-dihydroxyphenyl)-2,3-dimethylbutyl]benzene-1,2-diol | 4-[(2S,3R)-3-[(3,4-dihydroxyphenyl)methyl]-2-methylbutyl]benzene-1,2-diol | CHEMBL313972 | Masoprocol | NDGA | Nordihydroguaiaretic Acid
TypeAntioxidant
Emp. Form.C18H22O4
Mol. Mass.302.3649
SMILESC[C@@H](Cc1ccc(O)c(O)c1)[C@H](C)Cc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: