Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuraminidase
LigandBDBM50320770
Substrate/Competitorn/a
Meas. Tech.ChEMBL_639158
IC50 2150±n/a nM
Citation Wen WHWang SYTsai KCCheng YSYang ASFang JMWong CH Analogs of zanamivir with modified C4-substituents as the inhibitors against the group-1 neuraminidases of influenza viruses. Bioorg Med Chem 18:4074-84 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuraminidase
Name:Neuraminidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:49673.59
Organism:Influenza A virus
Description:ChEMBL_1347422
Residue:453
Sequence:
MNPNQKIITIGSICMVVGIISLILQIGNIISIWISHSIQTGNQNHTGICNQGSITYKVVA
GQDSTSVILTGNSSLCPIRGWAIHSKDNGIRIGSKGDVFVIREPFISCSHLECRTFFLTQ
GALLNDKHSRGTFKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGIS
GPDDGAVAVLKYNGIITETIKSWRKNILRTQESECTCVNGSCFTIMTDGPSDGLASYKIF
KIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYKIGY
ICSGVFGDNPRPKDGTGSCGPVSADGANGVKGFSYKYGNGVWIGRTKSDSSRHGFEMIWD
PNGWTETDSRFSMRQDVVAMTDRSGYSGSFVQHPELTGLDCMRPCFWVELIRGLPEENAI
WTSGSIISFCGVNSDTVDWSWPDGAELPFTIDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50320770
n/a
NameBDBM50320770
Synonyms:5-Acetamido-2,6-anhydro-4-[N-(3-piperazinocarbonyl)propyl]guanidino-3,4,5-trideoxy-D-glycero-D-galacto-non-2-enonic acid | CHEMBL1165529
TypeSmall organic molecule
Emp. Form.C20H34N6O8
Mol. Mass.486.5194
SMILESCC(=O)N[C@H]1[C@@H](OC(=C[C@@H]1N(CCCC(=O)N1CCNCC1)C(N)=N)C(O)=O)[C@H](O)[C@H](O)CO |r,c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: