| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-5 |
|---|
| Ligand | BDBM50320923 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_638038 (CHEMBL1166941) |
|---|
| IC50 | 6100±n/a nM |
|---|
| Citation |  Thanigaimalai, P; Yang, HM; Sharma, VK; Kim, Y; Jung, SH The scope of thallium nitrate oxidative cyclization of chalcones; synthesis and evaluation of isoflavone and aurone analogs for their inhibitory activity against interleukin-5. Bioorg Med Chem18:4441-5 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-5 |
|---|
| Name: | Interleukin-5 |
|---|
| Synonyms: | IL5_MOUSE | Il-5 | Il5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15414.97 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1464308 |
|---|
| Residue: | 133 |
|---|
| Sequence: | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ
LCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE
FLGVMSTEWAMEG
|
|
|
|---|
| BDBM50320923 |
|---|
| n/a |
|---|
| Name | BDBM50320923 |
|---|
| Synonyms: | 5-(Cyclohexylmethoxy)-3-(3,4,5-trimethoxyphenyl)-4Hchromen-4-one | CHEMBL1163759 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28O6 |
|---|
| Mol. Mass. | 424.4862 |
|---|
| SMILES | COc1ccc(c(OC)c1OC)-c1coc2cccc(OCC3CCCCC3)c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
