Reaction Details |
| Report a problem with these data |
Target | Type-2 angiotensin II receptor |
---|
Ligand | BDBM50321083 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_637186 (CHEMBL1167160) |
---|
Ki | 3.2±n/a nM |
---|
Citation | Mahalingam, AK; Wan, Y; Murugaiah, AM; Wallinder, C; Wu, X; Plouffe, B; Botros, M; Nyberg, F; Hallberg, A; Gallo-Payet, N; Alterman, M Selective angiotensin II AT(2) receptor agonists with reduced CYP 450 inhibition. Bioorg Med Chem18:4570-90 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Type-2 angiotensin II receptor |
---|
Name: | Type-2 angiotensin II receptor |
Synonyms: | Angiotensin type II receptor |
Type: | PROTEIN |
Mol. Mass.: | 15474.49 |
Organism: | Sus scrofa |
Description: | ChEMBL_1285617 |
Residue: | 137 |
Sequence: | MAFPPEKYAQWSAGIALMKNILGFIIPLVFIATCYFGIRKHLLKTNSYGKNRITRDQVLN
MAAAVVLAFIICWLPFHVLTFLDALAWMGIINSCEVIAVIDLALPFAILLGFTNSCINPF
LYCFVGNRFQQKLRSVF
|
|
|
BDBM50321083 |
---|
n/a |
---|
Name | BDBM50321083 |
Synonyms: | CHEMBL1164113 | N-Butyloxycarbonyl-3-[4-(thiazole-2-ylmethyl)-phenyl]-5-iso-butyl-thiophene-2-sulfonamide |
Type | Small organic molecule |
Emp. Form. | C23H28N2O4S3 |
Mol. Mass. | 492.674 |
SMILES | CCCCOC(=O)NS(=O)(=O)c1sc(CC(C)C)cc1-c1ccc(Cc2nccs2)cc1 |
Structure |
|